TRMT13 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRM13

Key Reference: N/A

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA:m(4)X modification enzyme TRM13 homolog

Protein Size: 481

Purification: Affinity purified

• SKU: AVIARP57328_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57328_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54482
• Host: Rabbit