TRMT6 Antibody - middle region : HRP

TRMT6 Antibody - middle region : HRP
SKU
AVIARP56780_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is similar to an uncharacterized protein from C. elegans. Although the function of the encoded protein is unknown, it shares weak sequence similarity to a region of S. cerevisiae translation initiation factor subunit Gcd10p.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRMT6

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6

Protein Size: 497

Purification: Affinity Purified

Subunit: TRM6
More Information
SKU AVIARP56780_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56780_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51605
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×