TRPC4AP Antibody - middle region : FITC

TRPC4AP Antibody - middle region : FITC
SKU
AVIARP55313_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRPC4AP

Key Reference: Tsang,H.T., (2006) Genomics 88 (3), 333-346

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Short transient receptor potential channel 4-associated protein

Protein Size: 797

Purification: Affinity Purified
More Information
SKU AVIARP55313_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55313_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26133
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×