Tspan33 Antibody - C-terminal region : Biotin

Tspan33 Antibody - C-terminal region : Biotin
SKU
AVIARP55782_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Tspan33 Ensembl ENSRNOP00000010989

Protein Size: 283

Purification: Affinity Purified
More Information
SKU AVIARP55782_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55782_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 500065
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×