TUB Antibody - N-terminal region : Biotin

TUB Antibody - N-terminal region : Biotin
SKU
AVIARP57909_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TUB functions in signal transduction from heterotrimeric G protein-coupled receptors. It could be involved in the hypothalamic regulation of body weight.This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUB

Key Reference: Snieder,H., (2008) Diabetologia 51 (1), 54-61

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubby protein homolog

Protein Size: 561

Purification: Affinity Purified
More Information
SKU AVIARP57909_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57909_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 7275
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×