TUBA8 Antibody - N-terminal region : Biotin

TUBA8 Antibody - N-terminal region : Biotin
SKU
AVIARP57298_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA8

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin alpha-8 chain

Protein Size: 449

Purification: Affinity Purified
More Information
SKU AVIARP57298_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57298_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51807
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×