TXNIP Antibody - middle region : FITC

TXNIP Antibody - middle region : FITC
SKU
AVIARP59054_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNIP

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thioredoxin-interacting protein

Protein Size: 391

Purification: Affinity Purified
More Information
SKU AVIARP59054_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59054_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10628
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×