UBAC2 Antibody - middle region : Biotin

UBAC2 Antibody - middle region : Biotin
SKU
AVIARP55756_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific functin of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBAC2

Key Reference: Dunham,A., (2004) Nature 428 (6982), 522-528

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-associated domain-containing protein 2

Protein Size: 309

Purification: Affinity Purified
More Information
SKU AVIARP55756_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55756_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 337867
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×