UBXN1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC51035

Key Reference: Wilson,P.A., (2006) J. Lipid Res. 47 (9), 1940-1949

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UBX domain-containing protein 1

Protein Size: 312

Purification: Affinity Purified

• SKU: AVIARP56764_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56764_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51035
• Host: Rabbit