UCHL1 Antibody - middle region : HRP

UCHL1 Antibody - middle region : HRP
SKU
AVIARP58967_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UCHL1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: AVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L1

Protein Size: 223

Purification: Affinity Purified
More Information
SKU AVIARP58967_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58967_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7345
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×