UQCRFS1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UQCRFS1

Key Reference: Xu,H., (2007) Acta Biochim. Biophys. Sin. (Shanghai) 39 (12), 964-973

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome b-c1 complex subunit Rieske, mitochondrial

Protein Size: 274

Purification: Affinity Purified

Subunit: Rieske, mitochondrial

• SKU: AVIARP58549_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58549_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7386
• Host: Rabbit