UVSSA Antibody - C-terminal region : FITC

UVSSA Antibody - C-terminal region : FITC
SKU
AVIARP57482_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UVSSA

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UV-stimulated scaffold protein A

Protein Size: 709

Purification: Affinity Purified
More Information
SKU AVIARP57482_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57482_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57654
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×