UVSSA Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UVSSA

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UV-stimulated scaffold protein A

Protein Size: 709

Purification: Affinity Purified

• SKU: AVIARP57482_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57482_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57654
• Host: Rabbit