VGLL1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: VGLL1 is a specific coactivator for the mammalian TEFs. The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VGLL1

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription cofactor vestigial-like protein 1

Protein Size: 258

Purification: Affinity Purified

• SKU: AVIARP58041_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58041_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51442
• Host: Rabbit