VPS28 Antibody - N-terminal region : Biotin

VPS28 Antibody - N-terminal region : Biotin
SKU
AVIARP56850_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal complexes required for transport) invol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS28

Key Reference: Hui,E.K., (2006) J. Virol. 80 (5), 2291-2308

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 28 homolog

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP56850_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56850_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51160
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×