VPS37C Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS37C

Key Reference: Eastman,S.W., (2005) J. Biol. Chem. 280 (1), 628-636

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar protein sorting-associated protein 37C

Protein Size: 355

Purification: Affinity Purified

• SKU: AVIARP57073_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57073_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55048
• Host: Rabbit