WDR55 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR55

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing protein 55

Protein Size: 383

Purification: Affinity Purified

• SKU: AVIARP57011_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57011_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54853
• Host: Rabbit