WDR5B Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This intronless gene encodes a protein containing several WD40 repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, including a trp-asp at the C-terminal end. The encoded protein may mediate protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR5B

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing protein 5B

Protein Size: 330

Purification: Affinity Purified

• SKU: AVIARP57325_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57325_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54554
• Host: Rabbit