WIPI1 Antibody - C-terminal region : Biotin

WIPI1 Antibody - C-terminal region : Biotin
SKU
AVIARP58980_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WIPI1

Key Reference: N/A

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat domain phosphoinositide-interacting protein 1

Protein Size: 446

Purification: Affinity purified
More Information
SKU AVIARP58980_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58980_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55062
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×