WIPI1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WIPI1

Key Reference: Eastman,S.W., (2007) FEBS Lett. 581 (18), 3396-3404

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: WD repeat domain phosphoinositide-interacting protein 1

Protein Size: 446

Purification: Affinity Purified

• SKU: AVIARP57076_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57076_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55062
• Host: Rabbit