YTHDF3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human YTHDF3

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: YTH domain family protein 3

Protein Size: 585

Purification: Affinity Purified

• SKU: AVIARP55530_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55530_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 253943
• Host: Rabbit