ZBED8 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC63920

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein ZBED8

Protein Size: 594

Purification: Affinity Purified

• SKU: AVIARP57587_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57587_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 63920
• Host: Rabbit