Zfp566 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Molecular Weight: 45 kDa

Peptide Sequence: Synthetic peptide located within the following region: YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Zfp566 Ensembl ENSRNOP00000051339

Protein Size: 386

Purification: Affinity Purified

• SKU: AVIARP58056_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58056_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 502316
• Host: Rabbit