ZFPL1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFPL1

Key Reference: Chiu,C.F., (2008) EMBO J. 27 (7), 934-947

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein-like 1

Protein Size: 310

Purification: Affinity Purified

• SKU: AVIARP58101_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58101_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7542
• Host: Rabbit