ZNF157 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23.

Immunogen: The immunogen for Anti-ZNF157 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN157

Key Reference: N/A

Molecular Weight: 55 kDa

Peptide Sequence: Synthetic peptide located within the following region: TYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 157

Protein Size: 506

Purification: Affinity purified

• SKU: AVIARP57911_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57911_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7712
• Host: Rabbit