ZNF174 Antibody - middle region : Biotin

ZNF174 Antibody - middle region : Biotin
SKU
AVIARP58108_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Zinc finger protein 174.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF174

Key Reference: Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 174

Protein Size: 407

Purification: Affinity Purified
More Information
SKU AVIARP58108_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58108_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7727
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×