ZNF358 Antibody - N-terminal region : Biotin

ZNF358 Antibody - N-terminal region : Biotin
SKU
AVIARP57958_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ZNF358 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF358

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: EDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 358

Protein Size: 568

Purification: Affinity Purified
More Information
SKU AVIARP57958_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57958_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 140467
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×