ZNF358 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF358 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF358

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: EDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 358

Protein Size: 568

Purification: Affinity Purified

• SKU: AVIARP57958_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57958_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 140467
• Host: Rabbit