ZNF675 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF675 may be involved in transcriptional regulation. It may play a role during osteoclast differentiation by modulating TRAF6 signaling activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF675

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: CDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 675

Protein Size: 568

Purification: Affinity Purified

• SKU: AVIARP57962_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57962_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 171392
• Host: Rabbit