ZNF764 Antibody - N-terminal region : HRP

ZNF764 Antibody - N-terminal region : HRP
SKU
AVIARP58137_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF764 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF764 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF764

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: APPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 764

Protein Size: 408

Purification: Affinity Purified
More Information
SKU AVIARP58137_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58137_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 92595
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×