Purity: Greater than 90% as determined by SDS-PAGE.
Species: Homo sapiens (Human).
Source: E.coli.
Expression Region: 39-215aa.
Molecular Weight: 36.7kDa.
Tag Info: N-terminal 6xHis-SUMO-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN.
Organism: Homo sapiens (Human). Function: Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma. Tag Info: N-terminal 6xHis-SUMO-tagged