Recombinant Human Ficolin-2 (FCN2)

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Homo sapiens (Human).

Source: Yeast.

Expression Region: 26-313aa.

Molecular Weight: 33.4kDa.

Tag Info: N-terminal 6xHis-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA.



Organism: Homo sapiens (Human). Function: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region. Subcellular Location: Secreted. Protein Families: Ficolin lectin family. Tissue Specificity: Expressed by the liver and secreted in plasma. Tag Info: N-terminal 6xHis-tagged

• SKU: CSB-YP620881HU-100
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-YP620881HU-100
• Green Labware: No
• Package Unit: 100 µg
• Quantity Unit: STK
• Reactivity: Human
• Application: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Host: Yeast