Recombinant Human Killer cell lectin-like receptor subfamily G member 1 (KLRG1), partial

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Homo sapiens (Human).

Source: E.coli.

Expression Region: 60-195aa.

Molecular Weight: 31.5kDa.

Tag Info: N-terminal 6xHis-SUMO-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF.



Organism: Homo sapiens (Human). Function: Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. Subcellular Location: Cell membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells. Tag Info: N-terminal 6xHis-SUMO-tagged

• SKU: CSB-EP846610HU-100
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP846610HU-100
• Green Labware: No
• Package Unit: 100 µg
• Quantity Unit: STK
• Reactivity: Human
• Application: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Host: Escherichia Coli