Recombinant Human Low affinity immunoglobulin epsilon Fc receptor (FCER2), partial

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Homo sapiens (Human).

Source: E.coli.

Expression Region: 48-321aa.

Molecular Weight: 47.0kDa.

Tag Info: N-terminal 6xHis-SUMO-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS.



Organism: Homo sapiens (Human). Function: Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen). Subcellular Location: Cell membrane, Single-pass type II membrane protein, Cell membrane, Lipid-anchor, Secreted. Tag Info: N-terminal 6xHis-SUMO-tagged

• SKU: CSB-EP008534HU-100
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP008534HU-100
• Green Labware: No
• Package Unit: 100 µg
• Quantity Unit: STK
• Reactivity: Human
• Application: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Host: Escherichia Coli