Purity: Greater than 90% as determined by SDS-PAGE.
Species: Homo sapiens (Human).
Source: Yeast.
Expression Region: 21-248aa.
Molecular Weight: 26.0kDa.
Tag Info: N-terminal 6xHis-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI.
Organism: Homo sapiens (Human). Function: Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA. Subcellular Location: Secreted. Tissue Specificity: Plasma protein produced mainly in the liver. Tag Info: N-terminal 6xHis-tagged