Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial

Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial
SKU
CSB-EP004925HU-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Purity: Greater than 85% as determined by SDS-PAGE.

Species: Homo sapiens (Human).

Source: E.coli.

Expression Region: 48-259aa.

Molecular Weight: 46.7 kDa.

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH.



Organism: Homo sapiens (Human) . Function: Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). Subcellular Location: Cell membrane, Single-pass type I membrane protein. Protein Families: Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family. Tissue Specificity: Monocytic/myeloid lineage cells. Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
More Information
SKU CSB-EP004925HU-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP004925HU-100
Green Labware No
Package Unit 100 µg
Quantity Unit STK
Host Escherichia Coli
Product information (PDF) Download
MSDS (PDF)
×