Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial
SKU
CSB-EP761623HU-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: Q6ZMC9

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 42.6 kDa

Gene Names: SIGLEC15

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 20-263aa

Protein Length: Extracellular Domain

Target Protein Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Endotoxin: Not test.

Relevance: Binds sialylated glycoproteins.

Reference: "Siglec-15: an immune system Siglec conserved throughout vertebrate evolution."Angata T., Tabuchi Y., Nakamura K., Nakamura M.Glycobiology 17:838-846(2007)

Function: Binds sialylated glycoproteins.
More Information
SKU CSB-EP761623HU-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP761623HU-1
Package Unit 1 mg
Quantity Unit STK
Reactivity Human
Application SDS-PAGE
Host Escherichia Coli
Product information (PDF) Download
MSDS (PDF) Download