Research Areas: Others
Uniprot: Q6ZMC9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-SUMO-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 42.6 kDa
Gene Names: SIGLEC15
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 20-263aa
Protein Length: Extracellular Domain
Target Protein Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Endotoxin: Not test.
Relevance: Binds sialylated glycoproteins.
Reference: "Siglec-15: an immune system Siglec conserved throughout vertebrate evolution."Angata T., Tabuchi Y., Nakamura K., Nakamura M.Glycobiology 17:838-846(2007)
Function: Binds sialylated glycoproteins.
English
Deutsch
