Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Homo sapiens (Human).

Source: E.coli.

Expression Region: 20-263aa.

Molecular Weight: 42.6kDa.

Tag Info: N-terminal 6xHis-SUMO-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST.



Organism: Homo sapiens (Human). Function: Binds sialylated glycoproteins. Subcellular Location: Membrane, Single-pass type I membrane protein. Protein Families: Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family. Tissue Specificity: Expressed in macrophage and/or dendritic cells of spleen and lymph nodes. Tag Info: N-terminal 6xHis-SUMO-tagged

• SKU: CSB-EP761623HU-100
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP761623HU-100
• Green Labware: No
• Package Unit: 100 µg
• Quantity Unit: STK
• Reactivity: Human
• Application: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Host: Escherichia Coli