Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Mus musculus (Mouse).

Source: E.coli.

Expression Region: 80-301aa.

Molecular Weight: 45.9kDa.

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH.



Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. MW: 45.9 kDa. Function: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed exclusively in hepatic parenchymal cells.

• SKU: CSB-EP002208MO1b3-100
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP002208MO1B3-100
• Green Labware: No
• Package Unit: 100 µg
• Quantity Unit: STK
• Reactivity: Mouse (Murine)
• Application: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Host: Escherichia Coli