Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial

Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial
SKU
CSB-EP874136MO-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Purity: Greater than 90% as determined by SDS-PAGE.

Species: Mus musculus (Mouse).

Source: E.coli.

Expression Region: 70-238aa.

Molecular Weight: 39.6kDa.

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL.



Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. MW: 39.6 kDa. Function: May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation (By similarity). May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Subcellular Location: Membrane, Single-pass type II membrane protein. Tissue Specificity: Expressed in splenic antigen-presenting cells including B-cells, monocytes/macrophages, and dendritic cells (at protein level). Expressed in spleen and lymph node and slightly increased with dendritic cell maturation.
More Information
SKU CSB-EP874136MO-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP874136MO-100
Green Labware No
Package Unit 100 µg
Quantity Unit STK
Reactivity Mouse (Murine)
Application Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
Host Escherichia Coli
Product information (PDF) Download
MSDS (PDF)
×