Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial

Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial
SKU
CSB-EP720664MO-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: Q64329

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 27.6 kDa

Gene Names: Klra3

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 70-266aa

Protein Length: Partial

Target Protein Sequence: QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

Endotoxin: Not test.

Relevance: Receptor on natural killer (NK) cells for class I MHC.

Reference: "Ly-49 multigene family. New members of a superfamily of type II membrane proteins with lectin-like domains."Wong S., Freeman J.D., Kelleher C., Mager D., Takei F.J. Immunol. 147:1417-1423(1991)

Function: Receptor on natural killer (NK) cells for class I MHC.
More Information
SKU CSB-EP720664MO-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP720664MO-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download