Research Areas: Others
Uniprot: Q64329
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 27.6 kDa
Gene Names: Klra3
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 70-266aa
Protein Length: Partial
Target Protein Sequence: QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
Endotoxin: Not test.
Relevance: Receptor on natural killer (NK) cells for class I MHC.
Reference: "Ly-49 multigene family. New members of a superfamily of type II membrane proteins with lectin-like domains."Wong S., Freeman J.D., Kelleher C., Mager D., Takei F.J. Immunol. 147:1417-1423(1991)
Function: Receptor on natural killer (NK) cells for class I MHC.
English
Deutsch
