Purity: Greater than 85% as determined by SDS-PAGE.
Species: Oncorhynchus keta (Chum salmon) (Salmo keta).
Source: E.coli.
Expression Region: 1-195aa.
Molecular Weight: 27.0 kDa.
Tag Info: N-terminal 10xHis-tagged.
Form: Liquid or Lyophilized powder.
Target Protein Sequence: AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD.
Tag Info: N-terminal 10xHis-tagged. MW: 27.0 kDa. L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.