Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3

Purity: Greater than 85% as determined by SDS-PAGE.

Species: Oncorhynchus keta (Chum salmon) (Salmo keta).

Source: Yeast.

Expression Region: 1-195aa.

Molecular Weight: 24.0 kDa.

Tag Info: N-terminal 10xHis-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD.



Organism: Oncorhynchus keta (Chum salmon) (Salmo keta). Function: L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis. Tag Info: N-terminal 10xHis-tagged

• SKU: CSB-YP309229OBG-100
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-YP309229OBG-100
• Green Labware: No
• Package Unit: 100 µg
• Quantity Unit: STK
• Reactivity: Fish (Salmon)
• Application: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Host: Yeast