Research Areas: Others
Uniprot: P18839
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 16.3 kDa
Gene Names: N/A
Organism: Rana japonica (Japanese reddish frog)
Source: E.coli
Expression Region: 1-111aa
Protein Length: Full Length
Target Protein Sequence: QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC
Endotoxin: Not test.
Relevance: The S-lectins in frog eggs may be involved in the fertilization and development of the frog bryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.
Reference: Amino acid sequence of a lectin from Japanese frog (Rana japonica) eggs.Kamiya Y., Oyama F., Oyama R., Sakakibara F., Nitta K., Kawauchi H., Takayanagi Y., Titani K.J. Biochem. 108:139-143(1990)
Function: The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.
English
Deutsch
