Recombinant Rat Galectin-3 (Lgals3)

Purity: Greater than 85% as determined by SDS-PAGE.

Species: Rattus norvegicus (Rat).

Source: E.coli.

Expression Region: 2-262aa.

Molecular Weight: 31.1 kDa.

Tag Info: N-terminal 6xHis-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI.



Organism: Rattus norvegicus (Rat). Function: Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. In the nucleus. Subcellular Location: Cytoplasm, Nucleus, Secreted. Tag Info: N-terminal 6xHis-tagged

• SKU: CSB-EP012887RA-1
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP012887RA-1
• Green Labware: No
• Package Unit: 1 mg
• Quantity Unit: STK
• Reactivity: Rat (Rattus)
• Host: Escherichia Coli