Recombinant Rat Galectin-4 (Lgals4)

Purity: Greater than 90% as determined by SDS-PAGE.

Species: Rattus norvegicus (Rat).

Source: E.coli.

Expression Region: 1-324aa.

Molecular Weight: 52.3kDa.

Tag Info: N-terminal 6xHis-SUMO-tagged.

Form: Liquid or Lyophilized powder.

Target Protein Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI.



Organism: Rattus norvegicus (Rat). Function: Galectin that binds lactose and a related range of sugars. Tissue Specificity: Highly expressed in full-length form in small and large intestine and stomach but was not detected in other tissues including lung, liver, kidney and spleen. Tag Info: N-terminal 6xHis-SUMO-tagged

• SKU: CSB-EP012889RA-1
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP012889RA-1
• Green Labware: No
• Package Unit: 1 mg
• Quantity Unit: STK
• Reactivity: Rat (Rattus)
• Application: Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
• Host: Escherichia Coli