Research Areas: Others
Uniprot: Q27084
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-SUMO-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 42.8 kDa
Gene Names: N/A
Organism: Tachypleus tridentatus (Japanese horseshoe crab)
Source: E.coli
Expression Region: 20-255aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: VGGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF
Endotoxin: Not test.
Relevance: Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab.
Reference: "Purification, characterization, and cDNA cloning of a 27-KDA lectin (L10) from horseshoe crab hemocytes."Okino N., Kawabata S., Saito T., Hirata M., Takagi T., Iwanaga S.J. Biol. Chem. 270:31008-31015(1995)
Function: Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab.
English
Deutsch
