Recombinant Human CD320 antigen (CD320), partial

Recombinant Human CD320 antigen (CD320), partial
SKU
CSB-EP865096HU1-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Immunology

Uniprot: Q9NPF0

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 47.1 kDa

Gene Names: CD320

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 36-231aa

Protein Length: Partial

Target Protein Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Endotoxin: Not test.

Relevance: Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.

Reference: Identification of a human follicular dendritic cell molecule that stimulates germinal center B cell growth.Li L., Zhang X., Kovacic S., Long A.J., Bourque K., Wood C.R., Choi Y.S.J. Exp. Med. 191:1077-1084(2000)

Function: Receptor for transcobalamin saturated with cobalamin (TCbl)
More Information
SKU CSB-EP865096HU1-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP865096HU1-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download