Research Areas: Immunology
Uniprot: Q9NPF0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal GST-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 47.1 kDa
Gene Names: CD320
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 36-231aa
Protein Length: Partial
Target Protein Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
Endotoxin: Not test.
Relevance: Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.
Reference: Identification of a human follicular dendritic cell molecule that stimulates germinal center B cell growth.Li L., Zhang X., Kovacic S., Long A.J., Bourque K., Wood C.R., Choi Y.S.J. Exp. Med. 191:1077-1084(2000)
Function: Receptor for transcobalamin saturated with cobalamin (TCbl)
English
Deutsch
